PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi1g61397.4.p
Common NameBRADI_1g61397
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 295aa    MW: 32506.4 Da    PI: 6.2304
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi1g61397.4.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding543.7e-171461148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      rg W++eEde+l + ++++G g+W+++++  g+ R++k+c++rw +yl
  Bradi1g61397.4.p 14 RGLWSPEEDEKLMNHIAKYGHGSWSSVPKLAGLERCGKSCRLRWINYL 61
                      788*******************************************97 PP

2Myb_DNA-binding53.46e-1767111147
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       rg +++eE++l+++++ +lG++ W+ Ia+ ++ gRt++++k++w++y
  Bradi1g61397.4.p  67 RGTFSQEEEDLIIHLHSMLGNK-WSQIASQLP-GRTDNEVKNFWNSY 111
                       899*******************.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.8E-27564IPR009057Homeodomain-like
PROSITE profilePS5129418.977961IPR017930Myb domain
SuperFamilySSF466896.36E-3111108IPR009057Homeodomain-like
SMARTSM007178.0E-131363IPR001005SANT/Myb domain
PfamPF002498.3E-161461IPR001005SANT/Myb domain
CDDcd001671.15E-111761No hitNo description
PROSITE profilePS5129426.82162116IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.5E-2665116IPR009057Homeodomain-like
SMARTSM007173.2E-1666114IPR001005SANT/Myb domain
PfamPF002496.5E-1667111IPR001005SANT/Myb domain
CDDcd001671.71E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
MAKQSCCHKK RLRRGLWSPE EDEKLMNHIA KYGHGSWSSV PKLAGLERCG KSCRLRWINY  60
LRPDLKRGTF SQEEEDLIIH LHSMLGNKWS QIASQLPGRT DNEVKNFWNS YIKKKLRERG  120
IDPATHKPLT EAPTSPTTTA CRAVFSDAEL NPTPTPAQVE QMLEGLKMPL DEDWPNNGMS  180
ECYQVPPGPC AFDMGALQQH CGGAFPSASS SSTLTGQQSP GASLPWLELG PTDGGHYAGA  240
LGDELRWSDY FDGACFQATT TLQGAQQQGQ YCAYDTGKDD DAAQLDVHGL SNWC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C4e-291211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3544391e-156AK354439.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1007F18.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003557879.10.0PREDICTED: myb-related protein 308-like
TrEMBLI1H5420.0I1H542_BRADI; Uncharacterized protein
TrEMBLA0A0Q3HFP50.0A0A0Q3HFP5_BRADI; Uncharacterized protein
STRINGBRADI1G61397.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30923385
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G57560.11e-76myb domain protein 50